PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016463074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 767aa    MW: 83641.8 Da    PI: 6.6746
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016463074.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   XP_016463074.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.1731973IPR017930Myb domain
TIGRFAMsTIGR015577.1E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-82464IPR009057Homeodomain-like
PfamPF002493.2E-132467IPR001005SANT/Myb domain
CDDcd001671.49E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MDSYSSGEEL VVKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAVIKG VPISQALDIE IPPPRPKRKP SNPYPRKTSV AAPSSQVGIK  120
DGKLSTPFSS ICEDRNLFDL EKEPITEKPG RNEKLGSVQE NQNKKNCSQG FALFKEGASA  180
PSLSPGKSLQ TLAEPAGSCT LNESLPATKG VINHDVTAKS FLTVGSKEHQ KLNILDAKQS  240
FQSNSSCNTF NEGKSCQSNE KLAQDEKKDQ PSQPDHFGKF SRNDMQVPHH YPRHVPVHIL  300
DGALGVSGAQ TTPDMFYPES VSHQIGGVQG LSNLYTNPTS SATSEHHSNA AMSSIHQSFP  360
CFHPNFTPIH DPDDYRSFLQ LSSTFSSLIF SALLQNPAAH AAASFAASFW PYANMEAPVD  420
SPTGNTASQI NSAPSMAAIA TATVAAATAW WAAHGLLPLC SPFHSSSTRV PTSATSMQVD  480
PCQPSVGKNE GREGSHNSPH AQQTVPDCSE ALQEHHSASE LPTSPSSESE DSEGRKLKTG  540
LTANDTEQGA AVTEIHEPNT GNGRKQVDRS SCGSNTPSSS DLETDALEKD EKGKEEPQEP  600
NVNLLAGDAG NRRGRNCISP NDFWKEVSEG GRIAFQALFT REKLPQSFSP SNDLKNKGKI  660
NLENVKEKPD EKGLSGSQLD LIDQASDMCS SHQAVEDNVL VIGNKEDAEK CLPIMELGQV  720
RLKARRTGFK PYKRCSLEAK DSRVTSSSCQ DEEKSAKRLR LEGEASI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ4249130.0JQ424913.1 Nicotiana attenuata late elongated hypocotyl (LHY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016463075.10.0PREDICTED: protein LHY-like
RefseqXP_016463074.10.0PREDICTED: protein LHY-like
RefseqXP_016463073.10.0PREDICTED: protein LHY-like
TrEMBLJ9PV710.0J9PV71_NICAT; Late elongated hypocotyl
STRINGSolyc10g005080.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.37e-50MYB_related family protein